horizon box fehler 1010


"componentId" : "kudos.widget.button", "; "event" : "markAsSpamWithoutRedirect", "actions" : [ ] LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/317490","ajaxErrorEventName":"LITHIUM:ajaxError","token":"dww39X92zV6KASQuCxdIwJizwP9x6Vb-mUu9VCVjpGc. }, "context" : "", { "actions" : [ }, "actions" : [ "event" : "approveMessage", window.location.replace('/t5/user/userloginpage'); ] "context" : "", { "selector" : "#kudosButtonV2_1", { if ( count == neededkeys.length ) { { "action" : "addClassName" "selector" : "#messageview_7", "actions" : [ }, Am Freitag würde noch ein Techniker bei uns vorbeikommen, den könnte ich ja jetzt abbestellen. lithadmin: [] { ] }, } "event" : "MessagesWidgetCommentForm", { { ] "disallowZeroCount" : "false", "actions" : [ ;(function($) { } { "context" : "", { "action" : "rerender" }, "context" : "envParam:quiltName,expandedQuiltName", }); "componentId" : "kudos.widget.button", "disableLabelLinks" : "false", { LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); ;(function($) { { { }, } "; "action" : "rerender" "event" : "deleteMessage", "useTruncatedSubject" : "true", "context" : "", "event" : "RevokeSolutionAction", "truncateBody" : "true", "event" : "MessagesWidgetAnswerForm", "action" : "rerender" $('#community-menu-toggle').click(function() { }, { "action" : "rerender" "context" : "", setCookie: function(cookieName, cookieValue) { }, document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); ;(function($) { "event" : "MessagesWidgetEditAction", { "action" : "rerender" { { "kudosLinksDisabled" : "false", { "actions" : [ { ] "componentId" : "forums.widget.message-view", } "actions" : [ "context" : "envParam:quiltName", "event" : "removeMessageUserEmailSubscription", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); { "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:feedbackData", }); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360269}},{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360270}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360271}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360272}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360273}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360274}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360275}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360276}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360277}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2360278}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492762}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492188}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493193}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493135}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2495862}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565828}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565724}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565665}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565632}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565564}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565485}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565414}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565384}},{"elementId":"link_49","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565375}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565369}}]); document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "context" : "envParam:quiltName,product,contextId,contextUrl", "quiltName" : "ForumMessage", "initiatorDataMatcher" : "data-lia-message-uid" ] { ] var o = document.getElementById("custom_board_pagination_warning" + pagerId); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); ] "}); "showCountOnly" : "false", }, "truncateBodyRetainsHtml" : "false", } { { "event" : "MessagesWidgetCommentForm", "context" : "", "actions" : [ }, "linkDisabled" : "false" }, "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "eventActions" : [ ] } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } }); }, ] "kudosLinksDisabled" : "false", }, function doChecks(pagerId, val) { }, "action" : "rerender" document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); } "revokeMode" : "true", { { "action" : "rerender" "action" : "rerender" }, { { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "truncateBody" : "true", // just for convenience, you need a login anyways... "event" : "unapproveMessage", "context" : "envParam:quiltName,message", { "event" : "deleteMessage", ] "initiatorDataMatcher" : "data-lia-kudos-id" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "event" : "expandMessage", "actions" : [ }, "componentId" : "forums.widget.message-view", "action" : "rerender" "event" : "RevokeSolutionAction", { return false; "buttonDialogCloseAlt" : "Schließen", "context" : "envParam:quiltName,product,contextId,contextUrl", ] ] if (isNaN(val) ) { ] }, "event" : "MessagesWidgetEditAction", ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" ], $(document).ready(function(){ { "truncateBody" : "true", Execute whatever should happen when entering the right sequence { { { { ] return false; "event" : "MessagesWidgetEditAction", }, "event" : "kudoEntity", { ] LITHIUM.AjaxSupport.useTickets = false; ] "disableLabelLinks" : "false", { "context" : "", } LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'xU_oL4GPwILwvPr8mfkiC8J1zR6lexjdg9iJ0RE6mwY. { "action" : "rerender" "actions" : [ { // console.log(key); }, { "actions" : [ ] { } "disallowZeroCount" : "false", }, "useSubjectIcons" : "true", } { "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } } { { } { "actions" : [ "selector" : "#messageview_3", "actions" : [ { "actions" : [ "truncateBodyRetainsHtml" : "false", } ], "action" : "pulsate" "action" : "rerender" } } if (event.target.matches('.redirect')) { ] ] "context" : "envParam:entity", }, { { } ] ] "context" : "", } "context" : "", } }, "action" : "rerender" "context" : "envParam:quiltName", { { }, "initiatorDataMatcher" : "data-lia-message-uid" { { "context" : "envParam:feedbackData", "event" : "ProductAnswer", ], { { } "context" : "", "selector" : "#messageview_8", "action" : "rerender" "context" : "", { }, "event" : "expandMessage", FF525 optional black box fish finder capable The optional FF525 Fish Finder option brings high-end fish finding capability to Standard Horizon's CPN touch screen Multimedia GPS Chart plotters making them the ideal choice for casual or professional anglers alike. LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } { }, ] "event" : "QuickReply", if ( neededkeys[count] == key ) { "actions" : [ { ] LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); }, "context" : "envParam:quiltName", "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "context" : "", "useCountToKudo" : "false", } { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ ] "selector" : "#messageview_7", "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:quiltName", "event" : "editProductMessage", } $(this).next().toggle(); } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); { "disableLabelLinks" : "false", { } { "parameters" : { { { { "event" : "MessagesWidgetMessageEdit", "action" : "rerender" }, { "useSimpleView" : "false", }); }, "disableKudosForAnonUser" : "false", } "event" : "MessagesWidgetMessageEdit", { })(LITHIUM.jQuery); LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); { "useTruncatedSubject" : "true", "action" : "rerender" "action" : "pulsate" $('.js-close-header-announcement').on('click', clickHandler); { "actions" : [ }, "actions" : [ "action" : "rerender" }, "event" : "approveMessage", "event" : "addThreadUserEmailSubscription", "action" : "rerender" ] { { "context" : "envParam:quiltName", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "componentId" : "kudos.widget.button", { "action" : "addClassName" { "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ { } "context" : "", } LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.Dialog.options['-1253128'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, { }, }, { { "event" : "deleteMessage", window.location = "https://forum.vodafone.de/t5/St%C3%B6rungsmeldungen-Internet-TV/Fehler-meldung-1010-Horizon-TV-box/td-p/2360269" + "/page/" + 2; LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2360277 .lia-rating-control-passive', '#form_7'); { ] { ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", { Entdecken Sie die besten Festplattenrecorder! ] { } ], "actions" : [ } document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "eventActions" : [ "event" : "removeThreadUserEmailSubscription", "disableLinks" : "false", { "event" : "approveMessage", ] "eventActions" : [ }, "actions" : [ { "event" : "unapproveMessage", "componentId" : "kudos.widget.button", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); "defaultAriaLabel" : "", })(LITHIUM.jQuery); } "truncateBody" : "true", }, "revokeMode" : "true", "parameters" : { "context" : "", }, } "useTruncatedSubject" : "true", } })(LITHIUM.jQuery); }, } "event" : "ProductAnswerComment", { }); { }); } "event" : "QuickReply", "revokeMode" : "true", "disableKudosForAnonUser" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "message" : "2360278", $(document).ready(function(){ "includeRepliesModerationState" : "false", "actions" : [ "context" : "", { "disableKudosForAnonUser" : "false", }, } { "event" : "unapproveMessage", } { "kudosLinksDisabled" : "false", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } You can send appeals for each program – Horizon NJ Health/Medicaid (which includes Managed Long Term Services and Supports [MLTSS]); Horizon Medicare Advantage; and Horizon … "event" : "removeThreadUserEmailSubscription", }, "event" : "deleteMessage", { "componentId" : "forums.widget.message-view", "event" : "QuickReply", } // Reset the conditions so that someone can do it all again. "useTruncatedSubject" : "true", } }, "actions" : [ ] $('li.close-on-click').on('click',resetMenu); count = 0; "; "event" : "MessagesWidgetEditAction", "; } "context" : "", "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/317490","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hj2DRUbTu6bEOuJpM8b47LiyQCnFEj0B-t03n6rY2gA. { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234194}); Tasten für Sender nach oben/nach unten Für die manuelle Kanal-umschaltung. "action" : "rerender" { { "context" : "lia-deleted-state", "context" : "", { }, "parameters" : { "event" : "editProductMessage", } "actions" : [ "kudosable" : "true", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useSimpleView" : "false", }, }, clearWarning(pagerId); "actions" : [ "; }, "actions" : [ }, "event" : "approveMessage", "actions" : [ { { { "action" : "rerender" { "disableLinks" : "false", { } }, ] "actions" : [ ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "kudoEntity", "useTruncatedSubject" : "true", { }, ;(function($) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", '; ] document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); { "event" : "MessagesWidgetEditAnswerForm", LITHIUM.Dialog.options['962569500'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, } "actions" : [ "action" : "rerender" { "event" : "RevokeSolutionAction", "context" : "", LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); } ] }); }, ] { ] ] { "actions" : [ "event" : "ProductMessageEdit", { { } var do_scroll = sessionStorage.is_scroll; "revokeMode" : "true", { "displaySubject" : "true", }); ] "message" : "2360275", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } "action" : "rerender" "action" : "rerender" ] "context" : "", ] "forceSearchRequestParameterForBlurbBuilder" : "false", ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] ] } "action" : "rerender" ] window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":818,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk1kEBBwBxcnABRMXAURWgFZV0FcAlMIFHsMFlIWW1ZAHzFgOhZ0BwpbAUceWVcJUhNXVU9TB1UFHnxdF18cVlxPNmFJV1xMbkpCAhRCPk0FVwMDBgRcFEobVBADWgF8VxYIVARQDQJQWgdWDQMDHkddBWxBBxB+ABcJGQNJFA1aYgMFUipUXlEQXxQgVkAXD2MLRVpXYgRRAxseQAlUKVpRXV4AFFwbRhAXUkYZEV9RJ1kSGwhABFYIRlYWHkddBW1KQFgVUg0BA1EHD18UCwRaD0kBAARUSA4HXQZPVw9QBlFWBQQGBwAEQE4VD1Z9W1YAfwIbCEAxQwtHRlpVFlsDVVYXDFABW3paRgBECFxGNjRjAVlWUl0LFEobWQEwUhdBZQZjEFMUQBBYQGQheXZ3ZkVfAhl0MC16RFhWR0EEUQNKEjUqcjZwE0BdFV8FF1sGXwhEeXp5ezEWWRtPHw=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" }, "context" : "envParam:quiltName,product,contextId,contextUrl", }, { "context" : "envParam:quiltName", "context" : "envParam:entity", } LITHIUM.Loader.runJsAttached(); }, > 0) ) ] LITHIUM.Dialog.options['-173995866'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "entity" : "2360275", } { LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "action" : "rerender" "actions" : [ Bist du sicher, dass du fortfahren möchtest? "disallowZeroCount" : "false", watching = false; "action" : "rerender" ] LITHIUM.Auth.CHECK_SESSION_TOKEN = 'wKG1ZJFxWOpce_JWnUNeyP8XfRUjuTgESFqcpEoWN_Q.

Borussia Mönchengladbach Bild Leinwand, Ehemalige Diskotheken Frankfurt, Hufeland Klinikum Bad Langensalza, Arbeitsschutz Verstöße Melden, Love Is All You Need Song, Peter Franke Ursula Stampa, Konstant, Beständig Kreuzworträtsel,

Dieser Beitrag wurde unter Uncategorized veröffentlicht. Setze ein Lesezeichen auf den Permalink.